(data stored in ACNUC7421 zone)

EMBL: CP000529.PE300

CP000529.PE300       Location/Qualifiers
FT   CDS             305021..305269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35627"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ9"
FT                   /protein_id="ABM35627.1"
FT                   /translation="MIYINATHAAKSLQIGKPAWGKRAGFGRPGPRDGPIEAKVVKARQ
FT                   KENSVSSAVAGWSRRTGIQDLALNNFPSVIPAKGRYC"
     MIYINATHAA KSLQIGKPAW GKRAGFGRPG PRDGPIEAKV VKARQKENSV SSAVAGWSRR        60
     TGIQDLALNN FPSVIPAKGR YC                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page