(data stored in ACNUC7421 zone)

EMBL: CP000529.PE303

CP000529.PE303       Location/Qualifiers
FT   CDS             complement(307738..308469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0307"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   pol:Bpro_0454 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35630"
FT                   /db_xref="GOA:A1VJ02"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ02"
FT                   /protein_id="ABM35630.1"
FT                   /translation="MSTTADLVALLKKELKTARMTYADLALALGMAESSVKRMLAKGDM
FT                   PLSRIDAICRALKLDFAELARKVADAQPLLAQLSEAQEKAVVADKKLLLVAICVLSQWT
FT                   LEQVTGSYRLSQAECIGYLAQLDRIGIIELKPLNRYRLKLAKTFRWRPHGPVMDYFRDN
FT                   ALLDYFSGGFDGSGEGLLLVHGSISRGLAPSFMERMQRVAQDFAQQHQADQKLADKDRE
FT                   GYTLLLAMRSWEFGAFVALRR"
     MSTTADLVAL LKKELKTARM TYADLALALG MAESSVKRML AKGDMPLSRI DAICRALKLD        60
     FAELARKVAD AQPLLAQLSE AQEKAVVADK KLLLVAICVL SQWTLEQVTG SYRLSQAECI       120
     GYLAQLDRIG IIELKPLNRY RLKLAKTFRW RPHGPVMDYF RDNALLDYFS GGFDGSGEGL       180
     LLVHGSISRG LAPSFMERMQ RVAQDFAQQH QADQKLADKD REGYTLLLAM RSWEFGAFVA       240
     LRR                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page