(data stored in ACNUC7421 zone)

EMBL: CP000529.PE308

CP000529.PE308       Location/Qualifiers
FT   CDS             312927..314201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35635"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ07"
FT                   /protein_id="ABM35635.1"
FT                   /translation="MLDVLQLVSTCHPSKEKFMSPQTDEASRTPLAPPDSFQLTPPEVL
FT                   RPLSDEVARKAVPLPAATQAAVEDQVQRFMDGLMSEDLQSEAFKARLDSAFALGREEIS
FT                   LAASLMQGRFMQRNFVGMEDSAAFKAVQEMRGHLDALNPGKDGDLLQPQKLLGIIPYGN
FT                   KLQGYFRKFQNAGEQMQKSMQKLYAARDDMQRDVVEIEATRGKMWDGMQKLAAAVQFAE
FT                   SLDRQLAAKVDGLKATDPERAKALEQEVLFYVRQNLLDILTQQSVCTNGYLALDVLKKT
FT                   GREMMNGCSRVATTGMSALAVAQTVARATGNQVKVMEMLTGVNSTIENLIAETGRQLNT
FT                   HVEKTTQFASNPLIGIEKMKEMFDQTFKAMDAMDTFRSKMVEVMGQNNTILQEQLARAD
FT                   QYIDRVRQQKAREVTQRTLSGPVAL"
     MLDVLQLVST CHPSKEKFMS PQTDEASRTP LAPPDSFQLT PPEVLRPLSD EVARKAVPLP        60
     AATQAAVEDQ VQRFMDGLMS EDLQSEAFKA RLDSAFALGR EEISLAASLM QGRFMQRNFV       120
     GMEDSAAFKA VQEMRGHLDA LNPGKDGDLL QPQKLLGIIP YGNKLQGYFR KFQNAGEQMQ       180
     KSMQKLYAAR DDMQRDVVEI EATRGKMWDG MQKLAAAVQF AESLDRQLAA KVDGLKATDP       240
     ERAKALEQEV LFYVRQNLLD ILTQQSVCTN GYLALDVLKK TGREMMNGCS RVATTGMSAL       300
     AVAQTVARAT GNQVKVMEML TGVNSTIENL IAETGRQLNT HVEKTTQFAS NPLIGIEKMK       360
     EMFDQTFKAM DAMDTFRSKM VEVMGQNNTI LQEQLARADQ YIDRVRQQKA REVTQRTLSG       420
     PVAL                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page