(data stored in ACNUC7421 zone)

EMBL: CP000529.PE309

CP000529.PE309       Location/Qualifiers
FT   CDS             314236..314685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0313"
FT                   /product="YiaAB two helix domain protein"
FT                   /note="PFAM: YiaAB two helix domain protein; KEGG:
FT                   pol:Bpro_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35636"
FT                   /db_xref="GOA:A1VJ08"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ08"
FT                   /protein_id="ABM35636.1"
FT                   /translation="MTTQYVMQRDTGGWRIQVWTSFTLAVLASGTGVMQLPSQELDRAF
FT                   LAIGFFFCLFAAFAAAKTVRDNRDGRVDTNGWIITVWVSFAAAVCLTAWGLWRMNIGDW
FT                   QKGYMVVSWMFLISSTFTLAKTIRDRYEADLMTRSNEPAPETRPA"
     MTTQYVMQRD TGGWRIQVWT SFTLAVLASG TGVMQLPSQE LDRAFLAIGF FFCLFAAFAA        60
     AKTVRDNRDG RVDTNGWIIT VWVSFAAAVC LTAWGLWRMN IGDWQKGYMV VSWMFLISST       120
     FTLAKTIRDR YEADLMTRSN EPAPETRPA                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page