(data stored in ACNUC7421 zone)

EMBL: CP000529.PE310

CP000529.PE310       Location/Qualifiers
FT   CDS             complement(314705..315595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35637"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ09"
FT                   /protein_id="ABM35637.1"
FT                   /translation="MRSSPSIPDGFNFIIHSFAPNQTNAMPEHKNDSRRAYANAPVNQR
FT                   TAPREVAKPPPVHASLKARAQKARQRQLLGPSISDLLARRTSGAPRQHEKLHPGVIAAT
FT                   VCAVAAASALVLIRTGAGLALAAALAALGGASWLWQHRSQRAASETMPMPAGPPPFEPE
FT                   ALRRIDEAFEATAAIVTGPLLAALVSLKAAAVRMALALNGVQADDGFTLDDRMYVIESI
FT                   RRYIPDTLSAYLQVPTAQRPVPGAGEGKSANDLLQGQLALLQSELEQREQRLHGSAVEA
FT                   LRRQQRFLQSKATRG"
     MRSSPSIPDG FNFIIHSFAP NQTNAMPEHK NDSRRAYANA PVNQRTAPRE VAKPPPVHAS        60
     LKARAQKARQ RQLLGPSISD LLARRTSGAP RQHEKLHPGV IAATVCAVAA ASALVLIRTG       120
     AGLALAAALA ALGGASWLWQ HRSQRAASET MPMPAGPPPF EPEALRRIDE AFEATAAIVT       180
     GPLLAALVSL KAAAVRMALA LNGVQADDGF TLDDRMYVIE SIRRYIPDTL SAYLQVPTAQ       240
     RPVPGAGEGK SANDLLQGQL ALLQSELEQR EQRLHGSAVE ALRRQQRFLQ SKATRG           296
//

If you have problems or comments...

PBIL Back to PBIL home page