(data stored in ACNUC7421 zone)

EMBL: CP000529.PE312

CP000529.PE312       Location/Qualifiers
FT   CDS             316942..318291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35639"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ11"
FT                   /protein_id="ABM35639.1"
FT                   /translation="MKAHLQAHLRNQVAALFFLLPVATALVALPATVMAQPAAPELRSL
FT                   EVTSDDGLRAGAELEFTVEGTPRSRVGLRINGVRRDIALRETERGVYTGSYTIKRQDRI
FT                   SPANPIRATLRTRNRNIAVNYSFPAGMANPAVAAPLAAPVPPVAVLKIERFSVAPIDKI
FT                   EPGAELKFSLNGPPGGSAEVEIPGVNRVSMREVRPGAYEGAYTLRRMDNLLPSRPIVAT
FT                   LRVGNQSVKSNLTQALTADAKPPVLRNLAPREGEAVVDRAAISVSATFDDAGGVGVDPK
FT                   SVRILLSGRNVTPDSEVTPQFFSYRADLPIGRHTVDVTARDMVGNAMHKTWGFDVVVPV
FT                   SAMPATVPLQITSHANNAIVDGGTTVVRGRTAPGAVVDIRVQAFIPVAALFGVNQEPMT
FT                   QRVQADGNGNFTFSFASQLPLPGTRYEVTMVSHKADLSTESKLVLFQKQG"
     MKAHLQAHLR NQVAALFFLL PVATALVALP ATVMAQPAAP ELRSLEVTSD DGLRAGAELE        60
     FTVEGTPRSR VGLRINGVRR DIALRETERG VYTGSYTIKR QDRISPANPI RATLRTRNRN       120
     IAVNYSFPAG MANPAVAAPL AAPVPPVAVL KIERFSVAPI DKIEPGAELK FSLNGPPGGS       180
     AEVEIPGVNR VSMREVRPGA YEGAYTLRRM DNLLPSRPIV ATLRVGNQSV KSNLTQALTA       240
     DAKPPVLRNL APREGEAVVD RAAISVSATF DDAGGVGVDP KSVRILLSGR NVTPDSEVTP       300
     QFFSYRADLP IGRHTVDVTA RDMVGNAMHK TWGFDVVVPV SAMPATVPLQ ITSHANNAIV       360
     DGGTTVVRGR TAPGAVVDIR VQAFIPVAAL FGVNQEPMTQ RVQADGNGNF TFSFASQLPL       420
     PGTRYEVTMV SHKADLSTES KLVLFQKQG                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page