(data stored in ACNUC7421 zone)

EMBL: CP000529.PE321

CP000529.PE321       Location/Qualifiers
FT   CDS             327973..328497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0325"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   ana:all4145 probable DNA-binding stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35648"
FT                   /db_xref="GOA:A1VJ20"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ20"
FT                   /protein_id="ABM35648.1"
FT                   /translation="MAKSPAKTILKATLQGAPAINIGISEKDRAAIAQGLSRLLADTYT
FT                   LYLTTHNFHWNVTGPMFNTLHTMFMVQYTELWNAVDPVAERIRSLGHPAPGSYAQFSLL
FT                   ATVPDVPVTPPKALEMVRILVQGHEAVARTARELFPMADEARDEPTADLLTQRMTVHEQ
FT                   TAWMLRSLLEE"
     MAKSPAKTIL KATLQGAPAI NIGISEKDRA AIAQGLSRLL ADTYTLYLTT HNFHWNVTGP        60
     MFNTLHTMFM VQYTELWNAV DPVAERIRSL GHPAPGSYAQ FSLLATVPDV PVTPPKALEM       120
     VRILVQGHEA VARTARELFP MADEARDEPT ADLLTQRMTV HEQTAWMLRS LLEE             174
//

If you have problems or comments...

PBIL Back to PBIL home page