(data stored in ACNUC7421 zone)

EMBL: CP000529.PE327

CP000529.PE327       Location/Qualifiers
FT   CDS             334796..335116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0331"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="TIGRFAM: ribosomal protein L24; KEGG: pol:Bpro_0486
FT                   ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35654"
FT                   /db_xref="GOA:A1VJ26"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ26"
FT                   /protein_id="ABM35654.1"
FT                   /translation="MNKIRKGDEIIVITGRDKGKRGTISLRVDDSYVLVDGINLVKKHT
FT                   KPNPLKGTTGGIVEKSMPIHQSNVAIFNAASGKADRVGIKLLADGKKTRVFKSSGEEIK
FT                   AA"
     MNKIRKGDEI IVITGRDKGK RGTISLRVDD SYVLVDGINL VKKHTKPNPL KGTTGGIVEK        60
     SMPIHQSNVA IFNAASGKAD RVGIKLLADG KKTRVFKSSG EEIKAA                      106
//

If you have problems or comments...

PBIL Back to PBIL home page