(data stored in ACNUC7421 zone)

EMBL: CP000529.PE328

CP000529.PE328       Location/Qualifiers
FT   CDS             335119..335658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0332"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: pol:Bpro_0487
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35655"
FT                   /db_xref="GOA:A1VJ27"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ27"
FT                   /protein_id="ABM35655.1"
FT                   /translation="MARLQDQYREKIAPALIEKFGYTTPMQVPRITKITLNMGVSEAVA
FT                   DKKVMDNAVADMAKIAGQKPVVTKAKKAIAGFKIREDLPIGCMVTLRGVQMYEFLDRFV
FT                   TVALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKVDALRGLNISITTTAKTD
FT                   EECKALLTAFRFPFKN"
     MARLQDQYRE KIAPALIEKF GYTTPMQVPR ITKITLNMGV SEAVADKKVM DNAVADMAKI        60
     AGQKPVVTKA KKAIAGFKIR EDLPIGCMVT LRGVQMYEFL DRFVTVALPR VRDFRGISGR       120
     AFDGRGNYNI GVKEQIIFPE IEYDKVDALR GLNISITTTA KTDEECKALL TAFRFPFKN        179
//

If you have problems or comments...

PBIL Back to PBIL home page