(data stored in ACNUC7421 zone)

EMBL: CP000529.PE33

CP000529.PE33        Location/Qualifiers
FT   CDS             32075..32929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0034"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   pol:Bpro_0068 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35360"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI82"
FT                   /protein_id="ABM35360.1"
FT                   /translation="MHTSLLDCLLEYEVSGPAHFLFNIEAAFHEGQEVVEERLTITPSM
FT                   KVRHFCNERSGNRFIRLDAPKGILSVNYHARVQLHPAPVPLHLDESPVTALPDEVLHDL
FT                   MPSRYCESDSMRRIAQQLFGHLPQGMSRVRAVESWIHESIEYQPGFTQSTTTAQDVFVQ
FT                   RVGVCRDFAHLGITLCRALNIPARLVVGYVHFAEPPQDFHAVFEAWLDGRWVLFDATRS
FT                   APIDRLVRIGTGRDAKDVAFATIFGDVKMLRKDITVEEGDMPPADDSEAAQPLAVVAGT
FT                   AGL"
     MHTSLLDCLL EYEVSGPAHF LFNIEAAFHE GQEVVEERLT ITPSMKVRHF CNERSGNRFI        60
     RLDAPKGILS VNYHARVQLH PAPVPLHLDE SPVTALPDEV LHDLMPSRYC ESDSMRRIAQ       120
     QLFGHLPQGM SRVRAVESWI HESIEYQPGF TQSTTTAQDV FVQRVGVCRD FAHLGITLCR       180
     ALNIPARLVV GYVHFAEPPQ DFHAVFEAWL DGRWVLFDAT RSAPIDRLVR IGTGRDAKDV       240
     AFATIFGDVK MLRKDITVEE GDMPPADDSE AAQPLAVVAG TAGL                        284
//

If you have problems or comments...

PBIL Back to PBIL home page