(data stored in ACNUC7421 zone)

EMBL: CP000529.PE331

CP000529.PE331       Location/Qualifiers
FT   CDS             336411..336944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0335"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: pol:Bpro_0490
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35658"
FT                   /db_xref="GOA:A1VJ30"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ30"
FT                   /protein_id="ABM35658.1"
FT                   /translation="MSRVAKMPVAIPEGVEIAIKDTQINVKGALGALALAQNAHVVIAS
FT                   NDGKLTFVPANDSRQANAMSGTMRQLVNNMVVGVTKGFQKKLNLVGVGFKAQAQGDKLN
FT                   LTVGYSHPVVMAMPAGITVATPTPTEVVIKGSDRQRVGQIAAEVRAVRPPEPYKGKGIR
FT                   YSDEKITIKETKKK"
     MSRVAKMPVA IPEGVEIAIK DTQINVKGAL GALALAQNAH VVIASNDGKL TFVPANDSRQ        60
     ANAMSGTMRQ LVNNMVVGVT KGFQKKLNLV GVGFKAQAQG DKLNLTVGYS HPVVMAMPAG       120
     ITVATPTPTE VVIKGSDRQR VGQIAAEVRA VRPPEPYKGK GIRYSDEKIT IKETKKK          177
//

If you have problems or comments...

PBIL Back to PBIL home page