(data stored in ACNUC7421 zone)

EMBL: CP000529.PE332

CP000529.PE332       Location/Qualifiers
FT   CDS             336956..337321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0336"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="PFAM: ribosomal protein L18P/L5E; KEGG:
FT                   pol:Bpro_0491 ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35659"
FT                   /db_xref="GOA:A1VJ31"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ31"
FT                   /protein_id="ABM35659.1"
FT                   /translation="MLTKKEQRLRRSRQTRIRIANQGVARLSVNRTNLHIYASVISGDG
FT                   TKVLASASTAEVEVRNEIGGSGKGGNVAAAQAIGKRIAEKAKAAGVEKVAFDRAGFAYH
FT                   GRVKALADAAREAGLQF"
     MLTKKEQRLR RSRQTRIRIA NQGVARLSVN RTNLHIYASV ISGDGTKVLA SASTAEVEVR        60
     NEIGGSGKGG NVAAAQAIGK RIAEKAKAAG VEKVAFDRAG FAYHGRVKAL ADAAREAGLQ       120
     F                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page