(data stored in ACNUC7421 zone)

EMBL: CP000529.PE334

CP000529.PE334       Location/Qualifiers
FT   CDS             337871..338053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0338"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: pol:Bpro_0493
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35661"
FT                   /db_xref="GOA:A1VJ33"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ33"
FT                   /protein_id="ABM35661.1"
FT                   /translation="MTKEIKVKVQLVRSPIGTQESHRATVRGLGLRGVNSVSELQDTPA
FT                   VRGMINKISYLVKVI"
     MTKEIKVKVQ LVRSPIGTQE SHRATVRGLG LRGVNSVSEL QDTPAVRGMI NKISYLVKVI        60
//

If you have problems or comments...

PBIL Back to PBIL home page