(data stored in ACNUC7421 zone)

EMBL: CP000529.PE337

CP000529.PE337       Location/Qualifiers
FT   CDS             339911..340024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0341"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: pol:Bpro_0497
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35664"
FT                   /db_xref="GOA:A1VJ36"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ36"
FT                   /protein_id="ABM35664.1"
FT                   /translation="MRVSASVKKICRNCKIIRRKGVVRVICTDPRHKQRQG"
     MRVSASVKKI CRNCKIIRRK GVVRVICTDP RHKQRQG                                 37
//

If you have problems or comments...

PBIL Back to PBIL home page