(data stored in ACNUC7421 zone)

EMBL: CP000529.PE339

CP000529.PE339       Location/Qualifiers
FT   CDS             340429..340833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0343"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: pol:Bpro_0499
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35666"
FT                   /db_xref="GOA:A1VJ38"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ38"
FT                   /protein_id="ABM35666.1"
FT                   /translation="MAKSPNNSAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGN
FT                   ALSWASSGGQGFKGSRKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRA
FT                   LGALGIRINSIADVTPVPHNGCRPQKRRRI"
     MAKSPNNSAA QRVRKKVRKN VADGIAHVHA SFNNTIITIT DRQGNALSWA SSGGQGFKGS        60
     RKSTPFAAQV ASEVAGRAAI EQGIKNLDVE IKGPGPGRES SVRALGALGI RINSIADVTP       120
     VPHNGCRPQK RRRI                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page