(data stored in ACNUC7421 zone)

EMBL: CP000529.PE341

CP000529.PE341       Location/Qualifiers
FT   CDS             341683..342675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0345"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: pol:Bpro_0501 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase, alpha subunit domain
FT                   protein; RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35668"
FT                   /db_xref="GOA:A1VJ40"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ40"
FT                   /protein_id="ABM35668.1"
FT                   /translation="MQTNLLKPKTINVEQLGANRAKVTLEPFERGYGHTLGNALRRVLL
FT                   SSMVGHAATEVTIAGVLHEYSSIDGVQEDVVNILLNLKGVVFKLHNRDEVTLSLRKDGE
FT                   GPITAADIQTPHDVEIVNPDHVIMNLSHGGKIDMQIKVENGRGYVPGNVRRYGDESPKS
FT                   IGRIVLDASFSPVKRVSYTVESARVEQRTDLDKLVLEIETNGAVTAEDAVRASAKILVE
FT                   QLAVFAQLEGNELGAIINDPAPRSSQQFDPILLRPVDELELTVRSANCLKAENIYYIGD
FT                   LIQRTENELLKTPNLGRKSLNEIKEVLASRGLTLGMRLESWPPAGLDKR"
     MQTNLLKPKT INVEQLGANR AKVTLEPFER GYGHTLGNAL RRVLLSSMVG HAATEVTIAG        60
     VLHEYSSIDG VQEDVVNILL NLKGVVFKLH NRDEVTLSLR KDGEGPITAA DIQTPHDVEI       120
     VNPDHVIMNL SHGGKIDMQI KVENGRGYVP GNVRRYGDES PKSIGRIVLD ASFSPVKRVS       180
     YTVESARVEQ RTDLDKLVLE IETNGAVTAE DAVRASAKIL VEQLAVFAQL EGNELGAIIN       240
     DPAPRSSQQF DPILLRPVDE LELTVRSANC LKAENIYYIG DLIQRTENEL LKTPNLGRKS       300
     LNEIKEVLAS RGLTLGMRLE SWPPAGLDKR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page