(data stored in ACNUC7421 zone)

EMBL: CP000529.PE342

CP000529.PE342       Location/Qualifiers
FT   CDS             342759..343160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0346"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: pol:Bpro_0502
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35669"
FT                   /db_xref="GOA:A1VJ41"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ41"
FT                   /protein_id="ABM35669.1"
FT                   /translation="MRHGHGLRKLNRTSEHRLAMLRNMMNSLLQHEAIKTTLPKAKELR
FT                   RVVEPMITLAKTPTLANKRLAFDRLRDRDMVVKLFAELGPRYQTRPGGYTRILKMGFRV
FT                   GDNAPMALVELVDRPDVSEEIKDDAAAAK"
     MRHGHGLRKL NRTSEHRLAM LRNMMNSLLQ HEAIKTTLPK AKELRRVVEP MITLAKTPTL        60
     ANKRLAFDRL RDRDMVVKLF AELGPRYQTR PGGYTRILKM GFRVGDNAPM ALVELVDRPD       120
     VSEEIKDDAA AAK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page