(data stored in ACNUC7421 zone)

EMBL: CP000529.PE347

CP000529.PE347       Location/Qualifiers
FT   CDS             complement(347159..347731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35674"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ46"
FT                   /protein_id="ABM35674.1"
FT                   /translation="MASLAPQTLLFDRTALRRDQGLDRPMNSKILRLAIFLVAFSALAA
FT                   CANAQNKPESTCPPAHGMKAEQLHGRWAVRFTDPPPGLPERATMLLKRHAEFSESLAGT
FT                   VSRELGRAAGTAAIAGHSAQAALAGDLDEGMLLLDESSDNISITGTWNGEMKAGSCGQV
FT                   YQGRWKDTSRSAAPDAPEVFFTLTKLP"
     MASLAPQTLL FDRTALRRDQ GLDRPMNSKI LRLAIFLVAF SALAACANAQ NKPESTCPPA        60
     HGMKAEQLHG RWAVRFTDPP PGLPERATML LKRHAEFSES LAGTVSRELG RAAGTAAIAG       120
     HSAQAALAGD LDEGMLLLDE SSDNISITGT WNGEMKAGSC GQVYQGRWKD TSRSAAPDAP       180
     EVFFTLTKLP                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page