(data stored in ACNUC7421 zone)

EMBL: CP000529.PE349

CP000529.PE349       Location/Qualifiers
FT   CDS             complement(350042..351274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0353"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein; KEGG:
FT                   pol:Bpro_1422 acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35676"
FT                   /db_xref="GOA:A1VJ48"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ48"
FT                   /protein_id="ABM35676.1"
FT                   /translation="MTLENHNTALDAWIDAHFDEEVQFLQALVRVPTDTPPGNNAPHAE
FT                   RTAELLENFGFEVEKYPVPTQAVKDYGLESLTNLVVRRQYGPGPVIALNAHGDVVPPGD
FT                   GWTHDPYGAEIVDGKLYGRASAVSKSDFASYTFAVRALEALGLPLQGGIELLFTYDEEF
FT                   GGELGPGWLLKNRLSRPDLLIAAGFSYQVITAHNGCLQMEVTVHGKMAHAAIPDTGIDA
FT                   LQGATAILTALYLQNQHYQSITSKVEGITHPYLNVGRIEGGTNTNVVPGKVTLRLDRRM
FT                   IPEENPAEVEAEVRRVILDAAATVPGITVEIKRLLMAGAWKPDNRNAALVQALQKHGEA
FT                   VFGEPIPTSGTPLYTDVRLFGAAGIPAAIYGAGPRTVLESNAKRADEHLVLEDLRRATK
FT                   VVARTLLELLQ"
     MTLENHNTAL DAWIDAHFDE EVQFLQALVR VPTDTPPGNN APHAERTAEL LENFGFEVEK        60
     YPVPTQAVKD YGLESLTNLV VRRQYGPGPV IALNAHGDVV PPGDGWTHDP YGAEIVDGKL       120
     YGRASAVSKS DFASYTFAVR ALEALGLPLQ GGIELLFTYD EEFGGELGPG WLLKNRLSRP       180
     DLLIAAGFSY QVITAHNGCL QMEVTVHGKM AHAAIPDTGI DALQGATAIL TALYLQNQHY       240
     QSITSKVEGI THPYLNVGRI EGGTNTNVVP GKVTLRLDRR MIPEENPAEV EAEVRRVILD       300
     AAATVPGITV EIKRLLMAGA WKPDNRNAAL VQALQKHGEA VFGEPIPTSG TPLYTDVRLF       360
     GAAGIPAAIY GAGPRTVLES NAKRADEHLV LEDLRRATKV VARTLLELLQ                  410
//

If you have problems or comments...

PBIL Back to PBIL home page