(data stored in ACNUC7421 zone)

EMBL: CP000529.PE350

CP000529.PE350       Location/Qualifiers
FT   CDS             complement(351271..353049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0354"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: pol:Bpro_1423 amidase,
FT                   hydantoinase/carbamoylase; TIGRFAM: amidase,
FT                   hydantoinase/carbamoylase family; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35677"
FT                   /db_xref="GOA:A1VJ49"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ49"
FT                   /protein_id="ABM35677.1"
FT                   /translation="MTITLDQLNAASQAEFTQLLDGSYEHSPWIAAQAWAQRPFASLAQ
FT                   LKLALVRVVRESGREAQLALIRAHPELAGKAMLSKTLTAESSHEQGKAGLSNCTPAEFA
FT                   RIHQLNANYNAKFGFPFILAVRGPRGLGLAKPEIIATFARRLDNPPDFELAEALRNIHR
FT                   IAEIRLNDKFGHSPDLGNLVWDWAEQLGTHSDPGYAERGELTVTYLTDAHQACARQLAH
FT                   WMRDDCSFDEVSIDAVGNVVGIYHGSDPQARRLLTGSHYDTVRNGGKYDGRLGIFVPMA
FT                   CVRELQRQGRRLPFGLEVVGFAEEEGQRYKATFLGSGALTGHFDAAWLDQKDADGITMR
FT                   EAMTQAGLRIDDIPALRRDPARYLGFVEVHIEQGPVLNALDLPLGVVTSINGSVRYVGE
FT                   IIGMASHAGTTPMNQRRDAATAAAELALYVEKRGGSAENLVATVGMLEVPGGSINVVPG
FT                   RCKFSLDIRATTDEVRDACAADIVHELQALCQRRGLHYRLEETMRAAAAPSARAWQQRW
FT                   ERAVEALGLPVFRMPSGAGHDAMKLHEIMPQAMLFVRGLNAGISHNPLEAITNDDAELC
FT                   VRAFQNLLDQLATEFP"
     MTITLDQLNA ASQAEFTQLL DGSYEHSPWI AAQAWAQRPF ASLAQLKLAL VRVVRESGRE        60
     AQLALIRAHP ELAGKAMLSK TLTAESSHEQ GKAGLSNCTP AEFARIHQLN ANYNAKFGFP       120
     FILAVRGPRG LGLAKPEIIA TFARRLDNPP DFELAEALRN IHRIAEIRLN DKFGHSPDLG       180
     NLVWDWAEQL GTHSDPGYAE RGELTVTYLT DAHQACARQL AHWMRDDCSF DEVSIDAVGN       240
     VVGIYHGSDP QARRLLTGSH YDTVRNGGKY DGRLGIFVPM ACVRELQRQG RRLPFGLEVV       300
     GFAEEEGQRY KATFLGSGAL TGHFDAAWLD QKDADGITMR EAMTQAGLRI DDIPALRRDP       360
     ARYLGFVEVH IEQGPVLNAL DLPLGVVTSI NGSVRYVGEI IGMASHAGTT PMNQRRDAAT       420
     AAAELALYVE KRGGSAENLV ATVGMLEVPG GSINVVPGRC KFSLDIRATT DEVRDACAAD       480
     IVHELQALCQ RRGLHYRLEE TMRAAAAPSA RAWQQRWERA VEALGLPVFR MPSGAGHDAM       540
     KLHEIMPQAM LFVRGLNAGI SHNPLEAITN DDAELCVRAF QNLLDQLATE FP               592
//

If you have problems or comments...

PBIL Back to PBIL home page