(data stored in ACNUC7421 zone)

EMBL: CP000529.PE352

CP000529.PE352       Location/Qualifiers
FT   CDS             354171..354527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0356"
FT                   /product="Transthyretin"
FT                   /note="PFAM: Transthyretin; KEGG: atc:AGR_C_4223 conserved
FT                   hypothetical protein PA1518"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35679"
FT                   /db_xref="GOA:A1VJ51"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ51"
FT                   /protein_id="ABM35679.1"
FT                   /translation="MGHLSTHVLDTMHGCPAAGMKLTLQRMDGAHVETLKEVVLNQDGR
FT                   SDGGPLLDASAMAAGRYRLLFEVGDYFRARGVALPEPAFIDTVPVDFGIADAQGHYHVP
FT                   LLVSPWTYSTYRGS"
     MGHLSTHVLD TMHGCPAAGM KLTLQRMDGA HVETLKEVVL NQDGRSDGGP LLDASAMAAG        60
     RYRLLFEVGD YFRARGVALP EPAFIDTVPV DFGIADAQGH YHVPLLVSPW TYSTYRGS         118
//

If you have problems or comments...

PBIL Back to PBIL home page