(data stored in ACNUC7421 zone)

EMBL: CP000529.PE357

CP000529.PE357       Location/Qualifiers
FT   CDS             360685..361191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35684"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ56"
FT                   /protein_id="ABM35684.1"
FT                   /translation="MKPKRLPGFTSFLCPYKKPENWRKASLQANQGNFYGQIQPQPSVY
FT                   IAWFVVSISLDASHSQPVQSFSSHVMNNSSSLRCSSCGFSVFNRRYPNCERCGAQLPQD
FT                   VAYSREEVAALRKRDMDEELARQAEKRPSPPGKSGDDSWLYFSFSGDSPDSSCSSDGGS
FT                   CSGAD"
     MKPKRLPGFT SFLCPYKKPE NWRKASLQAN QGNFYGQIQP QPSVYIAWFV VSISLDASHS        60
     QPVQSFSSHV MNNSSSLRCS SCGFSVFNRR YPNCERCGAQ LPQDVAYSRE EVAALRKRDM       120
     DEELARQAEK RPSPPGKSGD DSWLYFSFSG DSPDSSCSSD GGSCSGAD                    168
//

If you have problems or comments...

PBIL Back to PBIL home page