(data stored in ACNUC7421 zone)

EMBL: CP000529.PE360

CP000529.PE360       Location/Qualifiers
FT   CDS             364982..365347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35687"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ59"
FT                   /protein_id="ABM35687.1"
FT                   /translation="MHISDQEYFRSCIARERQLAQLLGHRHIEECYESAGTLWDNNQAL
FT                   PKWTRDWRACGPLMTEYGITVTYGDGPGHGGLARIGATTVHFTDHPTRDRAVMYGIVKE
FT                   LIFLIEHGKVGRPVQAA"
     MHISDQEYFR SCIARERQLA QLLGHRHIEE CYESAGTLWD NNQALPKWTR DWRACGPLMT        60
     EYGITVTYGD GPGHGGLARI GATTVHFTDH PTRDRAVMYG IVKELIFLIE HGKVGRPVQA       120
     A                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page