(data stored in ACNUC7421 zone)

EMBL: CP000529.PE363

CP000529.PE363       Location/Qualifiers
FT   CDS             complement(366415..366819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0367"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   noc:Noc_1488 Roadblock/LC7"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35690"
FT                   /db_xref="GOA:A1VJ62"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ62"
FT                   /protein_id="ABM35690.1"
FT                   /translation="MNFDNSSAEVTASKIRAALRSLCASSDTVEAAALVSHDGLIIASV
FT                   MSREVDVDRFGAMCASLLALANRAAKEVRRGDLRQIILDGSLGPMLLTRAGETGVLAVA
FT                   ATPSAKLGQLILDTRTTARAVSELTEPREA"
     MNFDNSSAEV TASKIRAALR SLCASSDTVE AAALVSHDGL IIASVMSREV DVDRFGAMCA        60
     SLLALANRAA KEVRRGDLRQ IILDGSLGPM LLTRAGETGV LAVAATPSAK LGQLILDTRT       120
     TARAVSELTE PREA                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page