(data stored in ACNUC7421 zone)

EMBL: CP000529.PE37

CP000529.PE37        Location/Qualifiers
FT   CDS             complement(39336..40070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35364"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI86"
FT                   /protein_id="ABM35364.1"
FT                   /translation="MNAIPADRLLWEESLPGGNHWSGRLRRGTALRLTDLQGGANVSAL
FT                   FYNAGQPLERYSMPDTLKSQHTGFLTAGHVCQSDMGRVLCSITADSLGWHDSWCGVSDA
FT                   AMVLARYGEKRYQQHRNAMHRNGRDNLLIELAKWGLGARDLVPGVNFFSKVVPDADGAL
FT                   SHVGGHSVAGSFVDLRFEMDTLVVLSSAPHPLDARADYAPADVQLAAWRADPVGADDAC
FT                   RTQCPQNGRAFTNTERYCGAAA"
     MNAIPADRLL WEESLPGGNH WSGRLRRGTA LRLTDLQGGA NVSALFYNAG QPLERYSMPD        60
     TLKSQHTGFL TAGHVCQSDM GRVLCSITAD SLGWHDSWCG VSDAAMVLAR YGEKRYQQHR       120
     NAMHRNGRDN LLIELAKWGL GARDLVPGVN FFSKVVPDAD GALSHVGGHS VAGSFVDLRF       180
     EMDTLVVLSS APHPLDARAD YAPADVQLAA WRADPVGADD ACRTQCPQNG RAFTNTERYC       240
     GAAA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page