(data stored in ACNUC7421 zone)

EMBL: CP000529.PE371

CP000529.PE371       Location/Qualifiers
FT   CDS             complement(372909..373373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0375"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   pol:Bpro_4258 CoA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35698"
FT                   /db_xref="GOA:A1VJ70"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ70"
FT                   /protein_id="ABM35698.1"
FT                   /translation="MQHLPAAERIPYILNHCRTIAVVGLSPKPHRASFDVARYMQAAGY
FT                   RIIPVNPNAAEVLGEKAYATLQEAARHEKIDLVNCFRNSEDIPPIVDEAIAIGARAVWM
FT                   QLGIAHPEAAARAEAAGLLVVQDHCIKIDHRVLMSSGLLKPLAQPAAPAR"
     MQHLPAAERI PYILNHCRTI AVVGLSPKPH RASFDVARYM QAAGYRIIPV NPNAAEVLGE        60
     KAYATLQEAA RHEKIDLVNC FRNSEDIPPI VDEAIAIGAR AVWMQLGIAH PEAAARAEAA       120
     GLLVVQDHCI KIDHRVLMSS GLLKPLAQPA APAR                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page