(data stored in ACNUC7421 zone)

EMBL: CP000529.PE373

CP000529.PE373       Location/Qualifiers
FT   CDS             375774..376268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0377"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   plu:plu2740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35700"
FT                   /db_xref="GOA:A1VJ72"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ72"
FT                   /protein_id="ABM35700.1"
FT                   /translation="MHKMRNTMPAPPLAISNAMATRLGALGQQIRTRRKALRLSATVAA
FT                   EAAGLSRVTLHRMEKGAPAVTMAAYLNVMAALGLDFSLSLPADPAAVAPAADHTGWIPA
FT                   RVRLGDYPQLKQLAWHVQGVDELTPAEALSIYERNWRHIDVAALQPHEQQLVDALRLAL
FT                   T"
     MHKMRNTMPA PPLAISNAMA TRLGALGQQI RTRRKALRLS ATVAAEAAGL SRVTLHRMEK        60
     GAPAVTMAAY LNVMAALGLD FSLSLPADPA AVAPAADHTG WIPARVRLGD YPQLKQLAWH       120
     VQGVDELTPA EALSIYERNW RHIDVAALQP HEQQLVDALR LALT                        164
//

If you have problems or comments...

PBIL Back to PBIL home page