(data stored in ACNUC7421 zone)

EMBL: CP000529.PE377

CP000529.PE377       Location/Qualifiers
FT   CDS             378109..378603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35704"
FT                   /db_xref="GOA:A1VJ76"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ76"
FT                   /protein_id="ABM35704.1"
FT                   /translation="MASVQDRALKTIAAFEGLKGLAAIASGLGLLSLLHHDIRHLALEL
FT                   VGHFGLNPAQHFPSLFLHYVDLLNSTPVSTLMLLLCGYAALRLAEAYALWRERAWGALL
FT                   GALSGGIYIPFEWRHLLHRPSLISAGVLAVNVLIVVFLAYRLWRRRVAIRSSKNSIELW
FT                   G"
     MASVQDRALK TIAAFEGLKG LAAIASGLGL LSLLHHDIRH LALELVGHFG LNPAQHFPSL        60
     FLHYVDLLNS TPVSTLMLLL CGYAALRLAE AYALWRERAW GALLGALSGG IYIPFEWRHL       120
     LHRPSLISAG VLAVNVLIVV FLAYRLWRRR VAIRSSKNSI ELWG                        164
//

If you have problems or comments...

PBIL Back to PBIL home page