(data stored in ACNUC7421 zone)

EMBL: CP000529.PE38

CP000529.PE38        Location/Qualifiers
FT   CDS             complement(40067..40897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0039"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: reu:Reut_B4886 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35365"
FT                   /db_xref="GOA:A1VI87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI87"
FT                   /protein_id="ABM35365.1"
FT                   /translation="MKIECKNVWKYFGQTTALQDVSLGIADNEFITLVGASGCGKSTLL
FT                   RTLAGLETHSKGDVLVEGKAITGPGQDRAMVFQHYSLYPWLRVSENIRFCRQLGAQTHN
FT                   RSSADVEAASGRADALLRLMGLTASAQAYPNQLSGGMQQRVAIARALMGKPQILLMDEP
FT                   FGALDAQTREVMHDLILHVHRLERTTIVFVTHDVEEAIYLGHRVVLMAPRPGRIDSIYD
FT                   VPLPARREQDMKLAPEFLRLKRQLLDRIRETSGMKTDLDQLQRLTQVAEERNPV"
     MKIECKNVWK YFGQTTALQD VSLGIADNEF ITLVGASGCG KSTLLRTLAG LETHSKGDVL        60
     VEGKAITGPG QDRAMVFQHY SLYPWLRVSE NIRFCRQLGA QTHNRSSADV EAASGRADAL       120
     LRLMGLTASA QAYPNQLSGG MQQRVAIARA LMGKPQILLM DEPFGALDAQ TREVMHDLIL       180
     HVHRLERTTI VFVTHDVEEA IYLGHRVVLM APRPGRIDSI YDVPLPARRE QDMKLAPEFL       240
     RLKRQLLDRI RETSGMKTDL DQLQRLTQVA EERNPV                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page