(data stored in ACNUC7421 zone)

EMBL: CP000529.PE380

CP000529.PE380       Location/Qualifiers
FT   CDS             complement(380445..382046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35707"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ79"
FT                   /protein_id="ABM35707.1"
FT                   /translation="MDHGLFSDKVPACFTSIGLAKIASDTLKEIFEETDEAKLKKKIKP
FT                   YSHDYIRYDALRDINIPRHLGIPHPGSYAIQALALSKHWQVIAEHCNQPDPSISRVHVR
FT                   KMGSDSIFKMNYKGSERYQLEEDEINWMAGAQFVVKADVASCYPSIYTHSIPWALHDKI
FT                   TTKKNQKITELAGNLLDKCTQNTRDGQTNGLLIGPHASSIISEIILTKIDTDLQKKYKK
FT                   IVRHIDDYTFFADTFDEAEKFVKDLGLCLRSYEMSLNYKKTSILPLPTPSVEDWIHRIN
FT                   SFDFPKDQEIGFSKIRSFLDLALECSRIAGKSTPLSYAIKILAGNTNSIKLNIRAKRLY
FT                   VLEVMNMALVYPYLVPLLDKAVFDKYGHPGLADKVSKLSTSLIRLGVRKLYFDIIAHAF
FT                   YYALKHNVTLDLKDNEFIEIINLNDCISNVMLFAYATKHNLYEVIKEINNFGKLLKLAD
FT                   SREKDKNWLLIYQLWSVSELNGSGQKFLADLKSINFQFLVVPQPVVEVETPDESIISPL
FT                   DSISIDNQLVNVTEQK"
     MDHGLFSDKV PACFTSIGLA KIASDTLKEI FEETDEAKLK KKIKPYSHDY IRYDALRDIN        60
     IPRHLGIPHP GSYAIQALAL SKHWQVIAEH CNQPDPSISR VHVRKMGSDS IFKMNYKGSE       120
     RYQLEEDEIN WMAGAQFVVK ADVASCYPSI YTHSIPWALH DKITTKKNQK ITELAGNLLD       180
     KCTQNTRDGQ TNGLLIGPHA SSIISEIILT KIDTDLQKKY KKIVRHIDDY TFFADTFDEA       240
     EKFVKDLGLC LRSYEMSLNY KKTSILPLPT PSVEDWIHRI NSFDFPKDQE IGFSKIRSFL       300
     DLALECSRIA GKSTPLSYAI KILAGNTNSI KLNIRAKRLY VLEVMNMALV YPYLVPLLDK       360
     AVFDKYGHPG LADKVSKLST SLIRLGVRKL YFDIIAHAFY YALKHNVTLD LKDNEFIEII       420
     NLNDCISNVM LFAYATKHNL YEVIKEINNF GKLLKLADSR EKDKNWLLIY QLWSVSELNG       480
     SGQKFLADLK SINFQFLVVP QPVVEVETPD ESIISPLDSI SIDNQLVNVT EQK              533
//

If you have problems or comments...

PBIL Back to PBIL home page