(data stored in ACNUC7421 zone)

EMBL: CP000529.PE381

CP000529.PE381       Location/Qualifiers
FT   CDS             382417..382674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35708"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ80"
FT                   /protein_id="ABM35708.1"
FT                   /translation="MPCPAGAKVRSTAALLVYEADRLAINKIAASAYAASTKSRFSLKN
FT                   QPRTASTQRKHRLQRRQQLLQRRRMHGTQALHQPHLVQRA"
     MPCPAGAKVR STAALLVYEA DRLAINKIAA SAYAASTKSR FSLKNQPRTA STQRKHRLQR        60
     RQQLLQRRRM HGTQALHQPH LVQRA                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page