(data stored in ACNUC7421 zone)

EMBL: CP000529.PE387

CP000529.PE387       Location/Qualifiers
FT   CDS             388119..388547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0391"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rpa:RPA3434
FT                   universal stress protein (Usp)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35714"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ86"
FT                   /protein_id="ABM35714.1"
FT                   /translation="MLKILIAVDGSEHADRAIEAVAAMARSSLELEATLLCVSPEPLFY
FT                   GSYTAATIQKIEDEQIVQQNAILAKAMEHARVAGLKVVAPARAYGVIANEIVRIAKDRQ
FT                   VDQIALGTRGMGAVGNMLLGSVAQRVLHQSPVPVLLVK"
     MLKILIAVDG SEHADRAIEA VAAMARSSLE LEATLLCVSP EPLFYGSYTA ATIQKIEDEQ        60
     IVQQNAILAK AMEHARVAGL KVVAPARAYG VIANEIVRIA KDRQVDQIAL GTRGMGAVGN       120
     MLLGSVAQRV LHQSPVPVLL VK                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page