(data stored in ACNUC7421 zone)

EMBL: CP000529.PE388

CP000529.PE388       Location/Qualifiers
FT   CDS             complement(388540..390396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0392"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: pol:Bpro_0723 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35715"
FT                   /db_xref="GOA:A1VJ87"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ87"
FT                   /protein_id="ABM35715.1"
FT                   /translation="MPGEMEVDPKQSWNLGYWVLALALLLLFQNVWQSASEALPVPYSE
FT                   FEKALSEGRIAEVSVTDRTLIGRLKTAEGKKTTLLSTRVEPDLAARLERYNVPYTRVVE
FT                   NTFFRDLLSWTLPTLIFFGVWFFLFRRFADKQGMGGFLSIGKSRAKIYVQTDTGVTFAD
FT                   VAGVDEARHELEEVVDFLKHPQEYGRLGAHIPKGVLLVGPPGTGKTLLAKAVAGEAGVP
FT                   FFSISGSEFVEMFVGVGAARVRDLFEQARGMAPAIIFIDELDALGRARGAFPGLGGHDE
FT                   KEQTLNQLLAEMDGFDASVGLIILAATNRPEILDPALLRAGRFDRQVLVDRPDRKGRTD
FT                   ILKVHVRKVKLDPGLDLGNVAALTPGFSGADLANLVNEATLVATRRKADLVTLADFTAA
FT                   VERIVAGLERRNRVLNPKEREAIAFHEMGHALVALAQPGTDPVHKVSIIPRGIGALGYT
FT                   IQRPTEDRYVMTRPELEQKIAVLLGGRAAEKLVFGVLSTGAADDLAKATDMARDMVTRY
FT                   GMDDNLGYVAFEPRRQQMLDVPADLMQPHSPAVSEHTQRRIDDAIRTIVMDGFARASAI
FT                   LGANRPVLERGAHALLEKETLDEAAIRALAADLRPSERQALT"
     MPGEMEVDPK QSWNLGYWVL ALALLLLFQN VWQSASEALP VPYSEFEKAL SEGRIAEVSV        60
     TDRTLIGRLK TAEGKKTTLL STRVEPDLAA RLERYNVPYT RVVENTFFRD LLSWTLPTLI       120
     FFGVWFFLFR RFADKQGMGG FLSIGKSRAK IYVQTDTGVT FADVAGVDEA RHELEEVVDF       180
     LKHPQEYGRL GAHIPKGVLL VGPPGTGKTL LAKAVAGEAG VPFFSISGSE FVEMFVGVGA       240
     ARVRDLFEQA RGMAPAIIFI DELDALGRAR GAFPGLGGHD EKEQTLNQLL AEMDGFDASV       300
     GLIILAATNR PEILDPALLR AGRFDRQVLV DRPDRKGRTD ILKVHVRKVK LDPGLDLGNV       360
     AALTPGFSGA DLANLVNEAT LVATRRKADL VTLADFTAAV ERIVAGLERR NRVLNPKERE       420
     AIAFHEMGHA LVALAQPGTD PVHKVSIIPR GIGALGYTIQ RPTEDRYVMT RPELEQKIAV       480
     LLGGRAAEKL VFGVLSTGAA DDLAKATDMA RDMVTRYGMD DNLGYVAFEP RRQQMLDVPA       540
     DLMQPHSPAV SEHTQRRIDD AIRTIVMDGF ARASAILGAN RPVLERGAHA LLEKETLDEA       600
     AIRALAADLR PSERQALT                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page