(data stored in ACNUC7421 zone)

EMBL: CP000529.PE39

CP000529.PE39        Location/Qualifiers
FT   CDS             complement(40903..41682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0040"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: reu:Reut_B4887
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35366"
FT                   /db_xref="GOA:A1VI88"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI88"
FT                   /protein_id="ABM35366.1"
FT                   /translation="MWSIRLAISRRSYGLLALVGLLVPLLGWALLSAFAGVSPVFLPGP
FT                   DKVVTRIGTWAMEDDLMGDAFISTMRVVTGWALSALLAIPLGLLIGSWRAVQALLEPLT
FT                   DFIRYMPAVAFIPLVMLWVGIDEGAKVAIIFIGTFFQMVLMVAEDVRRVPMAQIEAAQT
FT                   MGATRREVLEKVILPSAKPALLDTLRITMGWAWTYLVVAELVAANSGLGFAILKAQRFL
FT                   QTDKIFAGILLIGFIGLAIDQLFRLLHRKAFPWLHGR"
     MWSIRLAISR RSYGLLALVG LLVPLLGWAL LSAFAGVSPV FLPGPDKVVT RIGTWAMEDD        60
     LMGDAFISTM RVVTGWALSA LLAIPLGLLI GSWRAVQALL EPLTDFIRYM PAVAFIPLVM       120
     LWVGIDEGAK VAIIFIGTFF QMVLMVAEDV RRVPMAQIEA AQTMGATRRE VLEKVILPSA       180
     KPALLDTLRI TMGWAWTYLV VAELVAANSG LGFAILKAQR FLQTDKIFAG ILLIGFIGLA       240
     IDQLFRLLHR KAFPWLHGR                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page