(data stored in ACNUC7421 zone)

EMBL: CP000529.PE393

CP000529.PE393       Location/Qualifiers
FT   CDS             complement(394345..396612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0397"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: ade:Adeh_2956
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35720"
FT                   /db_xref="GOA:A1VJ92"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ92"
FT                   /protein_id="ABM35720.1"
FT                   /translation="MLKIRTYLVLMAVAILLPVVVFSTVALQMLRDGEREAALRGLQET
FT                   ARATALTVDRELASSVTALELLARSPHLESGDLQAFYKQAALLNKRPTSWTVLLDKNAQ
FT                   QLVNTARPFGEALPLPRDPGRVQEVMETQNSLASDLTVGQVTQKRVTVMYVPVPAHGGT
FT                   RYVLAQVFAIEFFNNTVFQPNTPINWVIAIIGRDGRFIARNLNAQERVGKPASADLMKA
FT                   AGAQDHGLIRHDTLDGTDAYNAFTHSAISGWTIGVAAPVNNIEATAGRAVAIATLGLLI
FT                   AITCAMMMAAFLGRRLVHSIAAATDAAAAMGHGTKPELTRSNVLELDQLHTALMQAGVI
FT                   LELAQASSAQAEEERECLLQDAYKARLRAEAESTAKDQFLAMLGHELRNPLAAIGGAIA
FT                   LSERHGHGSATAAEARAIIQRQSGHLAHLIDDLLDVSRMVGGKITLKPQPVDLGKKARS
FT                   CLESLRATRHMTGYELKVTTEPVWVNADPTRLEQMLNNLLVNAFKFTPPGGLVEVTVSA
FT                   CAQEAVLSVKDSGMGISPELLPHVFEMFVQGSASLDRAQGGLGIGLALVRQLASLHGGT
FT                   VSADSAGPGQGSTFVVRLPRIAAPVALPAAALPASSPHQRWRILLIEDNDDARHMMRRL
FT                   LDMEGHEVLEAATGTAGLRLASQQKPDLAIVDIGLPEMTGYEVAEHLRGDAETRSMGLI
FT                   AMTGYGQQEDRKHALAAGFDVHLVKSVDIDHLLKVIDQCGQAALLRKPGTGTAPIEGAS
FT                   HG"
     MLKIRTYLVL MAVAILLPVV VFSTVALQML RDGEREAALR GLQETARATA LTVDRELASS        60
     VTALELLARS PHLESGDLQA FYKQAALLNK RPTSWTVLLD KNAQQLVNTA RPFGEALPLP       120
     RDPGRVQEVM ETQNSLASDL TVGQVTQKRV TVMYVPVPAH GGTRYVLAQV FAIEFFNNTV       180
     FQPNTPINWV IAIIGRDGRF IARNLNAQER VGKPASADLM KAAGAQDHGL IRHDTLDGTD       240
     AYNAFTHSAI SGWTIGVAAP VNNIEATAGR AVAIATLGLL IAITCAMMMA AFLGRRLVHS       300
     IAAATDAAAA MGHGTKPELT RSNVLELDQL HTALMQAGVI LELAQASSAQ AEEERECLLQ       360
     DAYKARLRAE AESTAKDQFL AMLGHELRNP LAAIGGAIAL SERHGHGSAT AAEARAIIQR       420
     QSGHLAHLID DLLDVSRMVG GKITLKPQPV DLGKKARSCL ESLRATRHMT GYELKVTTEP       480
     VWVNADPTRL EQMLNNLLVN AFKFTPPGGL VEVTVSACAQ EAVLSVKDSG MGISPELLPH       540
     VFEMFVQGSA SLDRAQGGLG IGLALVRQLA SLHGGTVSAD SAGPGQGSTF VVRLPRIAAP       600
     VALPAAALPA SSPHQRWRIL LIEDNDDARH MMRRLLDMEG HEVLEAATGT AGLRLASQQK       660
     PDLAIVDIGL PEMTGYEVAE HLRGDAETRS MGLIAMTGYG QQEDRKHALA AGFDVHLVKS       720
     VDIDHLLKVI DQCGQAALLR KPGTGTAPIE GASHG                                  755
//

If you have problems or comments...

PBIL Back to PBIL home page