(data stored in ACNUC7421 zone)

EMBL: CP000529.PE394

CP000529.PE394       Location/Qualifiers
FT   CDS             complement(396843..397241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0398"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pol:Bpro_0882 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35721"
FT                   /db_xref="GOA:A1VJ93"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ93"
FT                   /protein_id="ABM35721.1"
FT                   /translation="MALKVFLVEDSAAQRAYLAQALRAEAKVEIVGIAETEHQAIHWLD
FT                   NNADQWDIALVDLFLGEGSGAGVIQHCHDRRPDQSVFVMTNHSQNEALLHHCKLLGADA
FT                   VYHKATELENLLALLQESAHSNSRCVAQ"
     MALKVFLVED SAAQRAYLAQ ALRAEAKVEI VGIAETEHQA IHWLDNNADQ WDIALVDLFL        60
     GEGSGAGVIQ HCHDRRPDQS VFVMTNHSQN EALLHHCKLL GADAVYHKAT ELENLLALLQ       120
     ESAHSNSRCV AQ                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page