(data stored in ACNUC7421 zone)

EMBL: CP000529.PE398

CP000529.PE398       Location/Qualifiers
FT   CDS             complement(400694..401629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0402"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pol:Bpro_4235 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35725"
FT                   /db_xref="GOA:A1VJ97"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ97"
FT                   /protein_id="ABM35725.1"
FT                   /translation="MTQRRADITRGLWLGLLGIVVFAVTLPMTRLAVGTPEAPQMSGLF
FT                   IAMGRALVAAALSAVFLVATRAPWPRRQDVPPLLLTAAGVVLGFPLLTSIAMRHVEAVH
FT                   ASVIVGVLPLATAAVGALLHRQRPSAGFWLCAGLGSALVVAFTMLRSGAPGGGLSIQLA
FT                   DLLLLAAMLCAAVGYGYGARLSQHLRAEHVICWALVMALPLTLPLSLANWPATPLKATA
FT                   WWGFAYLAVFSMWLGFFAWYRGLALGGTVRVSQVQLVQPFLSMLFAVPLLGERLDAVTA
FT                   GFGLAVIGVVFIGKKMPVNALPLASLPSRP"
     MTQRRADITR GLWLGLLGIV VFAVTLPMTR LAVGTPEAPQ MSGLFIAMGR ALVAAALSAV        60
     FLVATRAPWP RRQDVPPLLL TAAGVVLGFP LLTSIAMRHV EAVHASVIVG VLPLATAAVG       120
     ALLHRQRPSA GFWLCAGLGS ALVVAFTMLR SGAPGGGLSI QLADLLLLAA MLCAAVGYGY       180
     GARLSQHLRA EHVICWALVM ALPLTLPLSL ANWPATPLKA TAWWGFAYLA VFSMWLGFFA       240
     WYRGLALGGT VRVSQVQLVQ PFLSMLFAVP LLGERLDAVT AGFGLAVIGV VFIGKKMPVN       300
     ALPLASLPSR P                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page