(data stored in ACNUC7421 zone)

EMBL: CP000529.PE400

CP000529.PE400       Location/Qualifiers
FT   CDS             403967..404509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0404"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain; KEGG:
FT                   pcr:Pcryo_1048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35727"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ99"
FT                   /protein_id="ABM35727.1"
FT                   /translation="MAQPTVAASKAAASAAAPAVVKAVSVELTQFKVVKDAKGVEQLVA
FT                   APSVMPGDVIEYKVTYKNTSTKSVGGLVADLPIPEGLEYLPKSAKPGAALVKAAAKDGE
FT                   YAAEPLMRKLPGNKSEPVPYNEYRALRWSLGELPAGGVAAVTARAKVEAVVPTPPKTAP
FT                   ASVPSSAVTVKPASAAR"
     MAQPTVAASK AAASAAAPAV VKAVSVELTQ FKVVKDAKGV EQLVAAPSVM PGDVIEYKVT        60
     YKNTSTKSVG GLVADLPIPE GLEYLPKSAK PGAALVKAAA KDGEYAAEPL MRKLPGNKSE       120
     PVPYNEYRAL RWSLGELPAG GVAAVTARAK VEAVVPTPPK TAPASVPSSA VTVKPASAAR       180
//

If you have problems or comments...

PBIL Back to PBIL home page