(data stored in ACNUC7421 zone)

EMBL: CP000529.PE402

CP000529.PE402       Location/Qualifiers
FT   CDS             407611..414867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0406"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain; KEGG:
FT                   pcr:Pcryo_1046 protein of unknown function DUF11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35729"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA1"
FT                   /protein_id="ABM35729.1"
FT                   /translation="MATLLRRLRASRSPGAKHTLLSVCFALFSVPPATATPSGGTEKSQ
FT                   FFLNTNAGLAQRGPRKVSDVLFSSCIQRFIAALALGLAMLLAHVPAQAIPAQAGTVIRN
FT                   VASATYVPAGFTQVETADSNHVLVTVQAVEALSLTQDQNVVRPPSVQVTLNHLLTNTGN
FT                   VRSGYTIGFVGNGAGCPTQILNLSALRVLHDLNNNGVADAGDPVVTLGASGSITLQPGE
FT                   TAGLLVQGTLPASSAGSACVALTATTTAQATTASNRDIITVSNAAVLSLTKTASYPGVV
FT                   VPGTTRIDFTVTGTNIGAQDAQPVGTAAPANTAIVVNGAPINLVLIRDMIPAGTQYMPG
FT                   TLQTTAAGAIRLFRLAGDTAFSYRTEDDASAVEVAIGIPAAVVRNGTVALQFAVRAKAD
FT                   LSGEIRNIAQSYYHDGASPAVSPSNTVIIASSQGRIGVAKAASAPLLNQAANGELDGTA
FT                   TVRFSVLIRNYGSTALYSVQAPDVLEGAGATQFGSYTSNVVPAANQYTIVPGSLVIAKP
FT                   NGSVAGTVAAINPAFNGTAAAQNLLAAGALLPAGADITVQFDARINFTGRTGTLYNTVR
FT                   GQASVSPGDTPGIFDDSSNGTNPDVNGNGNPNDDSLPTPVSTLLPALSIIKTVSLPRRV
FT                   SLGVYEFDYTFKVTNTGQAEAPHVRVIDNLNCTFDMDKAEGAIASWELVTRPIVKHGNL
FT                   KTSASFTGRATCNRNQLNSTDPYLLPTEVVLSLVDGSRPLAPGQSEEVTLTLRVTEKPA
FT                   SIGSHLTLTNKAWAAAFGQNTVNVTPSLLVAAGSNSVRSLLLDPEGTVYNSITRQPVAG
FT                   ALVTYSRLSCSSGAGGPVTAAEIYGSGTGVYTFNANGTVSMTTGADGAWQFFLQSPPVT
FT                   NLCTYGITVAPPVGSGYVASQLIPVTPGSFDSCGAIVPNEAPPQNGEPTTHYFVLRAGV
FT                   NPDNSSCEAIHNHIPLDPGNLMGLVLRKDGSKKTAEFGDFIDYALTLTNKTGFPVTGAT
FT                   FNDFLPAGFAYVPNSARLNGAATANPAGGAGPQLVFSFPSLSLGVDQSATVRYRLRIGV
FT                   GAPTSGDAVNRAQASSGPMQSNQASWRVRVTGGVFSDEAFAFGTVHMECRRDGKEADGL
FT                   KNGGEEIGIPGVRLFMEDGTSVVTDIEGKWSLYGLKPVTHVLRVDETTLPPGAQLDLLD
FT                   NRNANNPASRFVDLKKGEFHKANFIVGNCDAPGVFQDVAARRKSLADRPDAEGEAAVRV
FT                   RLDPEAKAISVGDTRSLPATGQSSLTGAAGITVPASQALIQLPTGTANTNTFIGGVASA
FT                   GALNGTLGQAQQAGAFSPLIPLAGNNEVNGRSGFLLPAAQPLLQQAVPSSIELEKVMHS
FT                   LDNSAGFIDLKDQDTVASQTLNVRVKGAAGTQLRLHVNGQPIDDRRVGKKVVLPSASLG
FT                   AWEYIGVQLKPGINTLRLDVVDDYGVTRGTQQITLVAPDKLSLIQIDAPETAQADLRTP
FT                   VLIKVRLTDASGIPVTGRMQVTLEADRGRWLENDLNPSEPGAQVFIEGGVAEFRLLPPG
FT                   EPGDMRVRVSAGTFVKEARVALLPELRPMIGVGIIEGTLDFTKRSALTLGQMPAGAAFE
FT                   TELSGFASDGTSSSRGAARSAFFFKGAVQGDYLLTAAYDSDKTTKDRLFRDIRPDEFYP
FT                   VYGDSSVRGFDAQSTQKFYVRIDKNRSYLLYGDFTTASSSEVRQMSQSSRTLTGIKNVY
FT                   ESDTVRATSYASRTAQTQRIEEFPALGISGPYHLNAGNGDLLANSEKIEILVRDRNQPN
FT                   IVLQTTSVARFTDYTIEPLTSRLLFTRPIASVDTNLNPQSIRVTYEVDSGGAKFTVAGT
FT                   DVQVKLGEKLQVGMVASTDENPENKRKLGALTAIAHIAESTTVAAELVRTETDLKGTGS
FT                   AGRIEVRHHDEKLGAVAQIAKTSASFDNPGSAFSAGRTEAVARAQYKLDDTTQVRGEAI
FT                   YSKDALTTGDRKGVAVGVQKKLSETLLGEVGVRHGENSSPTASMFDYNQVSSSSALGAG
FT                   SLGNSVTSLGASAAAAGTSNQDITTVRGRLTTVVPHLPQAQVFVEAEQDINHGDRHVLA
FT                   AGGNYAITDKTRAYGRYEFISSLDGPYSLNNSSSRNIGILGIESNYMEGGRVYNEYRLA
FT                   DSLDGRTGQAAMGVRNTFKLNEQWRLTAGIERTKSIGSSASGIVGRGNSTAIVTGAEYL
FT                   SDRVKASGILEARQGDDSNSYLSSLGVGYKIDTDWSLLARSIISESKGQGTNAGNDRLL
FT                   SRQQIGIAYRPVDQDKWNALARYEHKTERVNGAGSVLGAVNSSSVFGSNAPGTYSADIV
FT                   SSHFNYNPQRGTYLTGRYAGKVSSADDGFLGSSYWAHLVQGRYTRDLSRDWDVGLQAGL
FT                   LYGKGGALQKTAGVELGYQVAKDLWVSAGYNVVGLKDRDLTAGEYTSEGVYIRLRFKFD
FT                   ENIFSTALPAVTK"
     MATLLRRLRA SRSPGAKHTL LSVCFALFSV PPATATPSGG TEKSQFFLNT NAGLAQRGPR        60
     KVSDVLFSSC IQRFIAALAL GLAMLLAHVP AQAIPAQAGT VIRNVASATY VPAGFTQVET       120
     ADSNHVLVTV QAVEALSLTQ DQNVVRPPSV QVTLNHLLTN TGNVRSGYTI GFVGNGAGCP       180
     TQILNLSALR VLHDLNNNGV ADAGDPVVTL GASGSITLQP GETAGLLVQG TLPASSAGSA       240
     CVALTATTTA QATTASNRDI ITVSNAAVLS LTKTASYPGV VVPGTTRIDF TVTGTNIGAQ       300
     DAQPVGTAAP ANTAIVVNGA PINLVLIRDM IPAGTQYMPG TLQTTAAGAI RLFRLAGDTA       360
     FSYRTEDDAS AVEVAIGIPA AVVRNGTVAL QFAVRAKADL SGEIRNIAQS YYHDGASPAV       420
     SPSNTVIIAS SQGRIGVAKA ASAPLLNQAA NGELDGTATV RFSVLIRNYG STALYSVQAP       480
     DVLEGAGATQ FGSYTSNVVP AANQYTIVPG SLVIAKPNGS VAGTVAAINP AFNGTAAAQN       540
     LLAAGALLPA GADITVQFDA RINFTGRTGT LYNTVRGQAS VSPGDTPGIF DDSSNGTNPD       600
     VNGNGNPNDD SLPTPVSTLL PALSIIKTVS LPRRVSLGVY EFDYTFKVTN TGQAEAPHVR       660
     VIDNLNCTFD MDKAEGAIAS WELVTRPIVK HGNLKTSASF TGRATCNRNQ LNSTDPYLLP       720
     TEVVLSLVDG SRPLAPGQSE EVTLTLRVTE KPASIGSHLT LTNKAWAAAF GQNTVNVTPS       780
     LLVAAGSNSV RSLLLDPEGT VYNSITRQPV AGALVTYSRL SCSSGAGGPV TAAEIYGSGT       840
     GVYTFNANGT VSMTTGADGA WQFFLQSPPV TNLCTYGITV APPVGSGYVA SQLIPVTPGS       900
     FDSCGAIVPN EAPPQNGEPT THYFVLRAGV NPDNSSCEAI HNHIPLDPGN LMGLVLRKDG       960
     SKKTAEFGDF IDYALTLTNK TGFPVTGATF NDFLPAGFAY VPNSARLNGA ATANPAGGAG      1020
     PQLVFSFPSL SLGVDQSATV RYRLRIGVGA PTSGDAVNRA QASSGPMQSN QASWRVRVTG      1080
     GVFSDEAFAF GTVHMECRRD GKEADGLKNG GEEIGIPGVR LFMEDGTSVV TDIEGKWSLY      1140
     GLKPVTHVLR VDETTLPPGA QLDLLDNRNA NNPASRFVDL KKGEFHKANF IVGNCDAPGV      1200
     FQDVAARRKS LADRPDAEGE AAVRVRLDPE AKAISVGDTR SLPATGQSSL TGAAGITVPA      1260
     SQALIQLPTG TANTNTFIGG VASAGALNGT LGQAQQAGAF SPLIPLAGNN EVNGRSGFLL      1320
     PAAQPLLQQA VPSSIELEKV MHSLDNSAGF IDLKDQDTVA SQTLNVRVKG AAGTQLRLHV      1380
     NGQPIDDRRV GKKVVLPSAS LGAWEYIGVQ LKPGINTLRL DVVDDYGVTR GTQQITLVAP      1440
     DKLSLIQIDA PETAQADLRT PVLIKVRLTD ASGIPVTGRM QVTLEADRGR WLENDLNPSE      1500
     PGAQVFIEGG VAEFRLLPPG EPGDMRVRVS AGTFVKEARV ALLPELRPMI GVGIIEGTLD      1560
     FTKRSALTLG QMPAGAAFET ELSGFASDGT SSSRGAARSA FFFKGAVQGD YLLTAAYDSD      1620
     KTTKDRLFRD IRPDEFYPVY GDSSVRGFDA QSTQKFYVRI DKNRSYLLYG DFTTASSSEV      1680
     RQMSQSSRTL TGIKNVYESD TVRATSYASR TAQTQRIEEF PALGISGPYH LNAGNGDLLA      1740
     NSEKIEILVR DRNQPNIVLQ TTSVARFTDY TIEPLTSRLL FTRPIASVDT NLNPQSIRVT      1800
     YEVDSGGAKF TVAGTDVQVK LGEKLQVGMV ASTDENPENK RKLGALTAIA HIAESTTVAA      1860
     ELVRTETDLK GTGSAGRIEV RHHDEKLGAV AQIAKTSASF DNPGSAFSAG RTEAVARAQY      1920
     KLDDTTQVRG EAIYSKDALT TGDRKGVAVG VQKKLSETLL GEVGVRHGEN SSPTASMFDY      1980
     NQVSSSSALG AGSLGNSVTS LGASAAAAGT SNQDITTVRG RLTTVVPHLP QAQVFVEAEQ      2040
     DINHGDRHVL AAGGNYAITD KTRAYGRYEF ISSLDGPYSL NNSSSRNIGI LGIESNYMEG      2100
     GRVYNEYRLA DSLDGRTGQA AMGVRNTFKL NEQWRLTAGI ERTKSIGSSA SGIVGRGNST      2160
     AIVTGAEYLS DRVKASGILE ARQGDDSNSY LSSLGVGYKI DTDWSLLARS IISESKGQGT      2220
     NAGNDRLLSR QQIGIAYRPV DQDKWNALAR YEHKTERVNG AGSVLGAVNS SSVFGSNAPG      2280
     TYSADIVSSH FNYNPQRGTY LTGRYAGKVS SADDGFLGSS YWAHLVQGRY TRDLSRDWDV      2340
     GLQAGLLYGK GGALQKTAGV ELGYQVAKDL WVSAGYNVVG LKDRDLTAGE YTSEGVYIRL      2400
     RFKFDENIFS TALPAVTK                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page