(data stored in ACNUC7421 zone)

EMBL: CP000529.PE407

CP000529.PE407       Location/Qualifiers
FT   CDS             complement(420397..420855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_PB00143 probable insertion sequence
FT                   transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35734"
FT                   /db_xref="GOA:A1VII9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII9"
FT                   /protein_id="ABM35734.1"
FT                   /translation="MSWRNGQAYAQDLRDRVLAAPGVLREVAERFGVSQAYVCRARARR
FT                   ERLGQTGPGAQHNHMPLRLAALEGALREQVARAPAQTLRELRQWVRAEHGIEVGTTTMF
FT                   KTLRRFGLTLKKNHPARGRANAARRRPGPPGLERQTTKPAGRSADLPR"
     MSWRNGQAYA QDLRDRVLAA PGVLREVAER FGVSQAYVCR ARARRERLGQ TGPGAQHNHM        60
     PLRLAALEGA LREQVARAPA QTLRELRQWV RAEHGIEVGT TTMFKTLRRF GLTLKKNHPA       120
     RGRANAARRR PGPPGLERQT TKPAGRSADL PR                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page