(data stored in ACNUC7421 zone)

EMBL: CP000529.PE410

CP000529.PE410       Location/Qualifiers
FT   CDS             431209..431571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35737"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA9"
FT                   /protein_id="ABM35737.1"
FT                   /translation="MIVVAAWMLDAAACAHMELGAPQASVGALAELHLLLSQRGFRRSC
FT                   AGVFHTCEERHEPSCTRTSPTVDDIGITSAISPTPAEPDPRVPGPSGHGLERTGRRGRT
FT                   AGNAAAAGSRPSNRKE"
     MIVVAAWMLD AAACAHMELG APQASVGALA ELHLLLSQRG FRRSCAGVFH TCEERHEPSC        60
     TRTSPTVDDI GITSAISPTP AEPDPRVPGP SGHGLERTGR RGRTAGNAAA AGSRPSNRKE       120
//

If you have problems or comments...

PBIL Back to PBIL home page