(data stored in ACNUC7421 zone)

EMBL: CP000529.PE418

CP000529.PE418       Location/Qualifiers
FT   CDS             complement(439115..439402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0423"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: rfr:Rfer_2710
FT                   IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35745"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB7"
FT                   /protein_id="ABM35745.1"
FT                   /translation="MRAGTDTALARVVAVFGAAHPHTAYLFANKRANRMKVLVHDGIGI
FT                   WLAARRLHQGKFIWPSQNTANCRLGREQLDALVLGLPWQRMGEAGIITIT"
     MRAGTDTALA RVVAVFGAAH PHTAYLFANK RANRMKVLVH DGIGIWLAAR RLHQGKFIWP        60
     SQNTANCRLG REQLDALVLG LPWQRMGEAG IITIT                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page