(data stored in ACNUC7421 zone)

EMBL: CP000529.PE42

CP000529.PE42        Location/Qualifiers
FT   CDS             complement(43586..44605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0043"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: gka:GK1971 C4-dicarboxylate transport system
FT                   (C4-dicarboxylate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35369"
FT                   /db_xref="GOA:A1VI91"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI91"
FT                   /protein_id="ABM35369.1"
FT                   /translation="MTFLRRTVIAAAAAVALSASFSALAQDIKPRLIRFGYGLNEQSNQ
FT                   GRAAKVFADEVAKASGGKMKVRAIGAAALGPDTQMQQALIGGAQEMMVGSTATLVGITK
FT                   EMALWDTPFLINNTKEADALLDGPIGEKIKDKLQDKGLVGLVYWENGFRNLTNSKRPVT
FT                   KVEDLDGIKLRVMQNNVFLSSFKTLGANAIPMAFSELFGALETKTVDGQENPYNTILSS
FT                   KFYEVQKYLTVTNHVYSPWIVLVSKKWWDQLSKAEQKVLMDAAKTSRDYERKDTREEAS
FT                   KAMADLKAKGMLVNELAPAEADRMRNKLTRVYAEIGTEVGMDLWIATQNELLKIRGKK"
     MTFLRRTVIA AAAAVALSAS FSALAQDIKP RLIRFGYGLN EQSNQGRAAK VFADEVAKAS        60
     GGKMKVRAIG AAALGPDTQM QQALIGGAQE MMVGSTATLV GITKEMALWD TPFLINNTKE       120
     ADALLDGPIG EKIKDKLQDK GLVGLVYWEN GFRNLTNSKR PVTKVEDLDG IKLRVMQNNV       180
     FLSSFKTLGA NAIPMAFSEL FGALETKTVD GQENPYNTIL SSKFYEVQKY LTVTNHVYSP       240
     WIVLVSKKWW DQLSKAEQKV LMDAAKTSRD YERKDTREEA SKAMADLKAK GMLVNELAPA       300
     EADRMRNKLT RVYAEIGTEV GMDLWIATQN ELLKIRGKK                              339
//

If you have problems or comments...

PBIL Back to PBIL home page