(data stored in ACNUC7421 zone)

EMBL: CP000529.PE423

CP000529.PE423       Location/Qualifiers
FT   CDS             444129..444617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3929 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35750"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC2"
FT                   /protein_id="ABM35750.1"
FT                   /translation="MPSGPAGKQACTNRPHIRLQPPLNLYSANACFLGGVHISADYFTN
FT                   HPADTPRITLVRAIKARWACEQAHQQLKDELGLDHYEGRSWLGLHHHALLSMIAFGYLQ
FT                   HRRLASALQAGKKTGIQCTGSPATAVIAGGTPRHHRHASSRDLRSVPSLQRHDRPASA"
     MPSGPAGKQA CTNRPHIRLQ PPLNLYSANA CFLGGVHISA DYFTNHPADT PRITLVRAIK        60
     ARWACEQAHQ QLKDELGLDH YEGRSWLGLH HHALLSMIAF GYLQHRRLAS ALQAGKKTGI       120
     QCTGSPATAV IAGGTPRHHR HASSRDLRSV PSLQRHDRPA SA                          162
//

If you have problems or comments...

PBIL Back to PBIL home page