(data stored in ACNUC7421 zone)

EMBL: CP000529.PE43

CP000529.PE43        Location/Qualifiers
FT   CDS             complement(44646..45938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0044"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: sme:SMa0250 conserved
FT                   hypothetical DedA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35370"
FT                   /db_xref="GOA:A1VI92"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI92"
FT                   /protein_id="ABM35370.1"
FT                   /translation="MSNEGLAFIVFSAGMLLLMGIGMNMGLALVLTGAGMAAVLGFWDT
FT                   QLLAQNLVAGVDSFPLLAVPFFILAGELMNSGGISSRIIAMAQAWVGHIRGGLGFVAIA
FT                   AAVMMASMSGSALADTAALATILLPMMRQQGYPMHTSAGLIASGGIIAPIIPPSMPFVI
FT                   YGVTTNTSISALFISGIVPGIIMGIGLIIAWKLVLRKMDLPQGQPLPMKERLRATAKAF
FT                   WAMLMPIIIIGGMKTGIFTPTEAAVVAAFYALFVALFVHREMKLAEIHGVLVRAGKTTA
FT                   IVMFLCAGAQVASYMITLADLPGTLTGWLGPLVESPKLLMAVMMIVLVIVGTALDLTPT
FT                   ILIFAPVMLPIAVKAGIDPVYFGLMFVLNGAIGLITPPVGTVLNVVAGVGRMPLHRVIQ
FT                   GVNPFLITYVLILVMFVIFPQIVTAPVAWMR"
     MSNEGLAFIV FSAGMLLLMG IGMNMGLALV LTGAGMAAVL GFWDTQLLAQ NLVAGVDSFP        60
     LLAVPFFILA GELMNSGGIS SRIIAMAQAW VGHIRGGLGF VAIAAAVMMA SMSGSALADT       120
     AALATILLPM MRQQGYPMHT SAGLIASGGI IAPIIPPSMP FVIYGVTTNT SISALFISGI       180
     VPGIIMGIGL IIAWKLVLRK MDLPQGQPLP MKERLRATAK AFWAMLMPII IIGGMKTGIF       240
     TPTEAAVVAA FYALFVALFV HREMKLAEIH GVLVRAGKTT AIVMFLCAGA QVASYMITLA       300
     DLPGTLTGWL GPLVESPKLL MAVMMIVLVI VGTALDLTPT ILIFAPVMLP IAVKAGIDPV       360
     YFGLMFVLNG AIGLITPPVG TVLNVVAGVG RMPLHRVIQG VNPFLITYVL ILVMFVIFPQ       420
     IVTAPVAWMR                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page