(data stored in ACNUC7421 zone)

EMBL: CP000529.PE431

CP000529.PE431       Location/Qualifiers
FT   CDS             451228..452340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0436"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: dra:DR2556
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35758"
FT                   /db_xref="GOA:A1VJD0"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD0"
FT                   /protein_id="ABM35758.1"
FT                   /translation="MALIVVIDDDAGTRLLVSQVLKKEGHKVMSAEDGAKGLDLIREHK
FT                   PDLVVSDVQMPLMDGFEVLDQVRSDAALAATAVILLTSLQDRSYMRLGMTTGADDYLTK
FT                   PFAPQELREAVSAQLNKRDRAHAMRTQVVDKAVQLALDEQRHKIGALYETRMVQALSEQ
FT                   WPDSSTAQGNERFASATVLYADMRDYGVWTQALSSTELSEIIQQLYSSVGDTVYLFGAH
FT                   YMQFVGDGMLCVFVDAADTKSVNHGLRAARAALGLVSATRRIDAHVQKNLAGRGLPNFS
FT                   LGVALHSGPVAFASLDGLISRTGQTTPVGDTVAAALKLFQGEPRLSWTVAASVQAVRLV
FT                   TGAVRTGQRALVQVPGRSQPMDVLEILGLA"
     MALIVVIDDD AGTRLLVSQV LKKEGHKVMS AEDGAKGLDL IREHKPDLVV SDVQMPLMDG        60
     FEVLDQVRSD AALAATAVIL LTSLQDRSYM RLGMTTGADD YLTKPFAPQE LREAVSAQLN       120
     KRDRAHAMRT QVVDKAVQLA LDEQRHKIGA LYETRMVQAL SEQWPDSSTA QGNERFASAT       180
     VLYADMRDYG VWTQALSSTE LSEIIQQLYS SVGDTVYLFG AHYMQFVGDG MLCVFVDAAD       240
     TKSVNHGLRA ARAALGLVSA TRRIDAHVQK NLAGRGLPNF SLGVALHSGP VAFASLDGLI       300
     SRTGQTTPVG DTVAAALKLF QGEPRLSWTV AASVQAVRLV TGAVRTGQRA LVQVPGRSQP       360
     MDVLEILGLA                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page