(data stored in ACNUC7421 zone)

EMBL: CP000529.PE434

CP000529.PE434       Location/Qualifiers
FT   CDS             456915..457784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0439"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: pol:Bpro_4209 CBS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35761"
FT                   /db_xref="GOA:A1VJD3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD3"
FT                   /protein_id="ABM35761.1"
FT                   /translation="MSDVPPSRSSKPEDKRGFLQKLAEMLHPGPDSKDELIETLVEAQD
FT                   NEVIGQQSREMLEGVIRMADMTAGDVMVAAPRMDLVNINAPFDELLHLIIDTAHSRFPV
FT                   FEDEKENIIGILMAKDLLKLQRAPELNIRALLRPAVFVPESKGLNELLREFRVNHNHLA
FT                   VVIDEFGRVAGLITIEDVLEQIVGEIEDEFDIAEDAGDIFALTDHTYRVSGDTSVERVN
FT                   ESFEVLLPDTDFETIGGLVAHEMGHVPKRGEHYALAGLQFTVLHTKGGAVRWFKVSPAA
FT                   VIQTSDAL"
     MSDVPPSRSS KPEDKRGFLQ KLAEMLHPGP DSKDELIETL VEAQDNEVIG QQSREMLEGV        60
     IRMADMTAGD VMVAAPRMDL VNINAPFDEL LHLIIDTAHS RFPVFEDEKE NIIGILMAKD       120
     LLKLQRAPEL NIRALLRPAV FVPESKGLNE LLREFRVNHN HLAVVIDEFG RVAGLITIED       180
     VLEQIVGEIE DEFDIAEDAG DIFALTDHTY RVSGDTSVER VNESFEVLLP DTDFETIGGL       240
     VAHEMGHVPK RGEHYALAGL QFTVLHTKGG AVRWFKVSPA AVIQTSDAL                   289
//

If you have problems or comments...

PBIL Back to PBIL home page