(data stored in ACNUC7421 zone)

EMBL: CP000529.PE438

CP000529.PE438       Location/Qualifiers
FT   CDS             461823..462749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0443"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   pol:Bpro_4203 glycine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35765"
FT                   /db_xref="GOA:A1VJD7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJD7"
FT                   /protein_id="ABM35765.1"
FT                   /translation="MLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALG
FT                   PEPWKAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDL
FT                   KKNDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLE
FT                   RLAMYLQGVDNVYNLTWTDGLTYGDVYKQNEVEQSTYNFEHSDTDFLFTAFSAHEKQAK
FT                   HLVEQQLALPAYEQVLKAGHSFNLLDARGAISVTERAAYIGRIRNLARAVAQSYYESRE
FT                   RLGFPLAPREWVEQMTKTSKTTTKKGA"
     MLTFQQIILK LQSYWADQGC ALLQPYDMEV GAGTSHTATF LRALGPEPWK AAYVQPSRRP        60
     KDGRYGENPN RLQHYYQYQV VLKPAPANIL ELYLGSLEAL GFDLKKNDIR FVEDDWENPT       120
     LGAWGLGWEV WLNGMEVTQF TYFQQVGGID CKPATGEITY GLERLAMYLQ GVDNVYNLTW       180
     TDGLTYGDVY KQNEVEQSTY NFEHSDTDFL FTAFSAHEKQ AKHLVEQQLA LPAYEQVLKA       240
     GHSFNLLDAR GAISVTERAA YIGRIRNLAR AVAQSYYESR ERLGFPLAPR EWVEQMTKTS       300
     KTTTKKGA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page