(data stored in ACNUC7421 zone)

EMBL: CP000529.PE444

CP000529.PE444       Location/Qualifiers
FT   CDS             468166..468606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0449"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pol:Bpro_4198 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35771"
FT                   /db_xref="GOA:A1VJE3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE3"
FT                   /protein_id="ABM35771.1"
FT                   /translation="MSDKLILVVEDNPDHLELTVLTLEELGLNAEIAVARDGAAALDYL
FT                   FGQGQHAGRDVRRQPAFVLLDMKLPKLSGLDVLRSVRSNPLTALVPVIMLTSSSEHSDM
FT                   VACYQSGANSFVRKPVDFVDFTEKLNRLQAYWLGVNESLAAV"
     MSDKLILVVE DNPDHLELTV LTLEELGLNA EIAVARDGAA ALDYLFGQGQ HAGRDVRRQP        60
     AFVLLDMKLP KLSGLDVLRS VRSNPLTALV PVIMLTSSSE HSDMVACYQS GANSFVRKPV       120
     DFVDFTEKLN RLQAYWLGVN ESLAAV                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page