(data stored in ACNUC7421 zone)

EMBL: CP000529.PE450

CP000529.PE450       Location/Qualifiers
FT   CDS             475729..476910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0455"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pol:Bpro_4190 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35777"
FT                   /db_xref="GOA:A1VJE9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE9"
FT                   /protein_id="ABM35777.1"
FT                   /translation="MNNMPGLNFQLGEDIDALRDAVRDFAQAEIAPRATEIDKSDQFPM
FT                   DLWEKMGALGVLGITVGEEYGGAGMGYLAHMIAMEEISRASASVGLSYGAHSNLCVNQI
FT                   KRNGSEAQRQKYLPKLISGEHVGALAMSEPGAGSDVISMKLKAEDKGGYYLLNGSKMWI
FT                   TNGPDADTLVVYAKTEPELGARGVTAFLIEKGMPGFSVAQKLDKLGMRGSHTGELVFQN
FT                   VEVPEQNILGNLNGGAKVLMSGLDYERAVLTGGPLGIMQSVMDNVLPYIHDRKQFGQSI
FT                   GEFQLIQGKVADMYTVLQAGRSFAYTVAKNLDMLGTDHVRQVRKDCASVILWCAEKATW
FT                   MAGEGIQIYGGNGYINEYPLGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETC"
     MNNMPGLNFQ LGEDIDALRD AVRDFAQAEI APRATEIDKS DQFPMDLWEK MGALGVLGIT        60
     VGEEYGGAGM GYLAHMIAME EISRASASVG LSYGAHSNLC VNQIKRNGSE AQRQKYLPKL       120
     ISGEHVGALA MSEPGAGSDV ISMKLKAEDK GGYYLLNGSK MWITNGPDAD TLVVYAKTEP       180
     ELGARGVTAF LIEKGMPGFS VAQKLDKLGM RGSHTGELVF QNVEVPEQNI LGNLNGGAKV       240
     LMSGLDYERA VLTGGPLGIM QSVMDNVLPY IHDRKQFGQS IGEFQLIQGK VADMYTVLQA       300
     GRSFAYTVAK NLDMLGTDHV RQVRKDCASV ILWCAEKATW MAGEGIQIYG GNGYINEYPL       360
     GRLWRDAKLY EIGAGTSEIR RMLIGRELFA ETC                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page